- CCDC190 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-82674
- This antibody was developed against Recombinant Protein corresponding to amino acids: KDVDPSKGIS VPCQNQEVST NTIEQGPSSS PASDSGMACA DETRSKDVAL KPDGNTGKQI
- 0.1 ml
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- Rabbit
- CCDC190
- coiled-coil domain containing 190
- IgG
- Polyclonal
- C1orf110
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KDVDPSKGISVPCQNQEVSTNTIEQGPSSSPASDSGMACADETRSKDVALKPDGNTGKQI
Specifications/Features
Available conjugates: Unconjugated